PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27928
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 414aa    MW: 45743.3 Da    PI: 6.9672
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27928genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-17101146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT+eEdell+++v+++G + W+ I+++++  R +kqc++rw + 
         EMT27928 101 RGPWTEEEDELLKRLVHEHGEHKWAIISEHLP-PRIGKQCRERWTNQ 146
                      89******************************.9**********985 PP

2Myb_DNA-binding391.8e-12157196445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      WT+ +d ll+da k  G+  W++Iar+++ gR+++ +k++w+
         EMT27928 157 WTEADDILLIDAQKARGNF-WSSIARCLP-GRSENAVKNHWN 196
                      *****************88.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.54196151IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-21100149IPR009057Homeodomain-like
SuperFamilySSF466894.59E-28100195IPR009057Homeodomain-like
SMARTSM007175.2E-18100149IPR001005SANT/Myb domain
PfamPF002494.9E-17101146IPR001005SANT/Myb domain
CDDcd001671.16E-16103145No hitNo description
Gene3DG3DSA:1.10.10.602.6E-14150199IPR009057Homeodomain-like
PROSITE profilePS5129413.015152203IPR017930Myb domain
SMARTSM007172.6E-9153201IPR001005SANT/Myb domain
PfamPF002491.4E-9157196IPR001005SANT/Myb domain
CDDcd001671.09E-9157196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MASLRDMLLN QELAADEYGR FERYTPSSAH GFSHFQQADS PPTGVPDTGS LVSGFGMPPS  60
TFIMPEGTHT AAGYGAEAVP VEIPVVRRQR SASRNTPASY RGPWTEEEDE LLKRLVHEHG  120
EHKWAIISEH LPPRIGKQCR ERWTNQLRPG IKKEHIWTEA DDILLIDAQK ARGNFWSSIA  180
RCLPGRSENA VKNHWNATRR SLKSKRRFKK TSQQAAPGQF TLLEEYIRDK MMADENVAPP  240
SPSSGLGYDG QVFPNAAAML AVSNPPGMGQ YLHPANAAGS SSQARIMNLS VPLPDLNAAY  300
SGEMLERYYD PASFPTYSNN NLLHHGPEPA FLQMFSAQGR MLAACTNLKL FPLPQHLGGG  360
YYGSETGSSS AGGSSDQDED VVQMASREFQ LDLTGPHWLQ LTRSVHRIDP VPIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-341012004102C-Myb DNA-Binding Domain
1mse_C3e-341012004102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8C1L20.0M8C1L2_AEGTA; Transcription factor MYB98
STRINGMLOC_14401.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.17e-36myb domain protein 118